Lineage for d1h7wa3 (1h7w A:288-440)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67065Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 67066Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 67067Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (3 proteins)
  6. 67077Protein Dihydropyrimidine dehydrogenase, domain 3 [51911] (1 species)
  7. 67078Species Pig (Sus scrofa) [TaxId:9823] [51912] (2 PDB entries)
  8. 67079Domain d1h7wa3: 1h7w A:288-440 [30324]
    Other proteins in same PDB: d1h7wa1, d1h7wa2, d1h7wa4, d1h7wa5, d1h7wb1, d1h7wb2, d1h7wb4, d1h7wb5, d1h7wc1, d1h7wc2, d1h7wc4, d1h7wc5, d1h7wd1, d1h7wd2, d1h7wd4, d1h7wd5

Details for d1h7wa3

PDB Entry: 1h7w (more details), 1.9 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig

SCOP Domain Sequences for d1h7wa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h7wa3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa)}
pktddifqgltqdqgfytskdflplvaksskagmcachsplpsirgavivlgagdtafdc
atsalrcgarrvflvfrkgfvniravpeevelakeekceflpflsprkvivkggrivavq
fvrteqdetgkwnededqivhlkadvvisafgs

SCOP Domain Coordinates for d1h7wa3:

Click to download the PDB-style file with coordinates for d1h7wa3.
(The format of our PDB-style files is described here.)

Timeline for d1h7wa3: