Lineage for d1vfka6 (1vfk A:503-585)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2419799Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2419800Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2419801Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2420087Protein Maltogenic amylase [51031] (4 species)
  7. 2420101Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (12 PDB entries)
  8. 2420110Domain d1vfka6: 1vfk A:503-585 [303224]
    Other proteins in same PDB: d1vfka4, d1vfka5, d1vfkb4, d1vfkb5
    automated match to d1bvza2
    complexed with ca, glc

Details for d1vfka6

PDB Entry: 1vfk (more details), 2.9 Å

PDB Description: Crystal structure of Thermoactinomyces vulgaris R-47 alpha-amylase 2/acarbose complex
PDB Compounds: (A:) Neopullulanase 2

SCOPe Domain Sequences for d1vfka6:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vfka6 b.71.1.1 (A:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

SCOPe Domain Coordinates for d1vfka6:

Click to download the PDB-style file with coordinates for d1vfka6.
(The format of our PDB-style files is described here.)

Timeline for d1vfka6: