SCOPe 2.08: Domain d1vfka6: 1vfk A:503-585

Lineage for d1vfka6 (1vfk A:503-585)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Maltogenic amylase [51031] (4 species)

7. Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (12 PDB entries)

8. Domain d1vfka6: 1vfk A:503-585 [303224]
   Other proteins in same PDB: d1vfka4, d1vfka5, d1vfkb4, d1vfkb5
   automated match to d1bvza2
   complexed with ca, glc

Details for d1vfka6

PDB Entry: 1vfk, 2.9 Å

PDB Description: Crystal structure of Thermoactinomyces vulgaris R-47 alpha-amylase 2/acarbose complex

PDB Compounds: (A:) Neopullulanase 2

SCOPe Domain Sequences for d1vfka6:

Sequence; same for both SEQRES and ATOM records:

>d1vfka6 b.71.1.1 (A:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

Timeline for d1vfka6:

• d1vfka6 first appeared in SCOPe 2.06
  
• d1vfka6 appears in SCOPe 2.07