Lineage for d1e1ka1 (1e1k A:107-331)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 20781Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 20782Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 20783Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (3 proteins)
  6. 20784Protein Adrenodoxin reductase of mitochondrial p450 systems [51909] (1 species)
  7. 20785Species Cow (Bos taurus) [TaxId:9913] [51910] (5 PDB entries)
  8. 20788Domain d1e1ka1: 1e1k A:107-331 [30321]
    Other proteins in same PDB: d1e1ka2

Details for d1e1ka1

PDB Entry: 1e1k (more details), 1.95 Å

PDB Description: adrenodoxin reductase in complex with nadp+ obtained by a soaking experiment

SCOP Domain Sequences for d1e1ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e1ka1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus)}
hqaldipgeelpgvfsarafvgwynglpenrelapdlscdtavilgqgnvaldvarillt
ppdhlektditeaalgalrqsrvktvwivgrrgplqvaftikelremiqlpgtrpmldpa
dflglqdrikeaarprkrlmelllrtatekpgveeaarrasasrawglrffrspqqvlps
pdgrraagirlavtrlegigeatravptgdvedlpcglvlssigy

SCOP Domain Coordinates for d1e1ka1:

Click to download the PDB-style file with coordinates for d1e1ka1.
(The format of our PDB-style files is described here.)

Timeline for d1e1ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e1ka2