Lineage for d2tmda2 (2tmd A:490-645)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119015Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 119016Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 119017Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (3 proteins)
  6. 119037Protein Trimethylamine dehydrogenase, C-terminal domain [51907] (1 species)
  7. 119038Species Methylophilus methylotrophus, w3a1 [TaxId:17] [51908] (3 PDB entries)
  8. 119043Domain d2tmda2: 2tmd A:490-645 [30317]
    Other proteins in same PDB: d2tmda1, d2tmda3, d2tmdb1, d2tmdb3

Details for d2tmda2

PDB Entry: 2tmd (more details), 2.4 Å

PDB Description: correlation of x-ray deduced and experimental amino acid sequences of trimethylamine dehydrogenase

SCOP Domain Sequences for d2tmda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tmda2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1}
rwntdgtnclthdpipgadaslpdqltpeqvmdgkkkigkrvvilnadtyfmapslaekl
ataghevtivsgvhlanymhftleypnmmrrlhelhveelgdhfcsriepgrmeiyniwg
dgskrtyrgpgvsprdantshrwiefdslvlvtgrh

SCOP Domain Coordinates for d2tmda2:

Click to download the PDB-style file with coordinates for d2tmda2.
(The format of our PDB-style files is described here.)

Timeline for d2tmda2: