SCOPe 2.07: Domain d1um3q1: 1um3 Q:12-45

Lineage for d1um3q1 (1um3 Q:12-45)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families)

5. Family f.23.12.0: automated matches [254198] (1 protein)
   not a true family

6. Protein automated matches [254432] (4 species)
   not a true protein

7. Species Mastigocladus laminosus [TaxId:83541] [255131] (4 PDB entries)

8. Domain d1um3q1: 1um3 Q:12-45 [303152]
   Other proteins in same PDB: d1um3a_, d1um3b_, d1um3d2, d1um3f_, d1um3h_, d1um3n_, d1um3o_, d1um3q2, d1um3s_, d1um3t_, d1um3u_
   automated match to d2e76d2
   complexed with bcr, cla, fes, hem, opc, pl9, tds

Details for d1um3q1

PDB Entry: 1um3, 3 Å

PDB Description: Crystal Structure of Cytochrome b6f Complex from M.laminosus

PDB Compounds: (Q:) Rieske iron-sulfur protein

SCOPe Domain Sequences for d1um3q1:

Sequence; same for both SEQRES and ATOM records:

>d1um3q1 f.23.12.0 (Q:12-45) automated matches {Mastigocladus laminosus [TaxId: 83541]}
dmgrrqfmnllafgtvtgvalgalyplvkyfipp

Timeline for d1um3q1:

• d1um3q1 first appeared in SCOPe 2.06
  
• d1um3q1 appears in the current release, SCOPe 2.08