Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily) core: three transmembrane helices, up-and-down bundle |
Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) |
Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins) a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
Protein automated matches [254659] (2 species) not a true protein |
Species Mastigocladus laminosus [TaxId:83541] [311181] (1 PDB entry) |
Domain d1um3o_: 1um3 O: [303151] Other proteins in same PDB: d1um3a_, d1um3d1, d1um3d2, d1um3f_, d1um3h_, d1um3n_, d1um3q1, d1um3q2, d1um3s_, d1um3t_, d1um3u_ automated match to d2e74b1 complexed with bcr, cla, fes, hem, opc, pl9, tds |
PDB Entry: 1um3 (more details), 3 Å
SCOPe Domain Sequences for d1um3o_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1um3o_ f.32.1.1 (O:) automated matches {Mastigocladus laminosus [TaxId: 83541]} lakgmghnyygepawpndllyvfpvvimgtfacivalsvldpamvgepanpfatpleilp ewylypvfqilrslpnkllgvllmasvplglilvpfienvnkfqnpfrrpvattiflfgt lvtiwlgigaalpldktl
Timeline for d1um3o_: