Lineage for d1um3o_ (1um3 O:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027980Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 3027981Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) (S)
  5. 3027982Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 3028043Protein automated matches [254659] (2 species)
    not a true protein
  7. 3028044Species Mastigocladus laminosus [TaxId:83541] [311181] (1 PDB entry)
  8. 3028046Domain d1um3o_: 1um3 O: [303151]
    Other proteins in same PDB: d1um3a_, d1um3d1, d1um3d2, d1um3f_, d1um3h_, d1um3n_, d1um3q1, d1um3q2, d1um3s_, d1um3t_, d1um3u_
    automated match to d2e74b1
    complexed with bcr, cla, fes, hem, opc, pl9, tds

Details for d1um3o_

PDB Entry: 1um3 (more details), 3 Å

PDB Description: Crystal Structure of Cytochrome b6f Complex from M.laminosus
PDB Compounds: (O:) subunit IV

SCOPe Domain Sequences for d1um3o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1um3o_ f.32.1.1 (O:) automated matches {Mastigocladus laminosus [TaxId: 83541]}
lakgmghnyygepawpndllyvfpvvimgtfacivalsvldpamvgepanpfatpleilp
ewylypvfqilrslpnkllgvllmasvplglilvpfienvnkfqnpfrrpvattiflfgt
lvtiwlgigaalpldktl

SCOPe Domain Coordinates for d1um3o_:

Click to download the PDB-style file with coordinates for d1um3o_.
(The format of our PDB-style files is described here.)

Timeline for d1um3o_: