SCOPe 2.08: Domain d1um3n_: 1um3 N:

Lineage for d1um3n_ (1um3 N:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families)
   Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically

5. Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
   a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein automated matches [196844] (6 species)
   not a true protein

7. Species Mastigocladus laminosus [TaxId:83541] [196845] (5 PDB entries)

8. Domain d1um3n_: 1um3 N: [303150]
   Other proteins in same PDB: d1um3b_, d1um3d1, d1um3d2, d1um3f_, d1um3h_, d1um3o_, d1um3q1, d1um3q2, d1um3s_, d1um3t_, d1um3u_
   automated match to d2e74a_
   complexed with bcr, cla, fes, hem, opc, pl9, tds

Details for d1um3n_

PDB Entry: 1um3, 3 Å

PDB Description: Crystal Structure of Cytochrome b6f Complex from M.laminosus

PDB Compounds: (N:) Cytochrome b6

SCOPe Domain Sequences for d1um3n_:

Sequence; same for both SEQRES and ATOM records:

>d1um3n_ f.21.1.2 (N:) automated matches {Mastigocladus laminosus [TaxId: 83541]}
eiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykptvteayasvqyi
mnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwisgvilavitvsfg
vtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatltryysahtfvlp
wliavfmllhflmirkqgisgp

Timeline for d1um3n_:

• d1um3n_ first appeared in SCOPe 2.06
  
• d1um3n_ appears in SCOPe 2.07