Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) |
Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins) |
Protein Threonine synthase [64172] (4 species) |
Species Thermus thermophilus [TaxId:274] [102667] (6 PDB entries) |
Domain d1uiqb_: 1uiq B: [303140] automated match to d1v7ca_ complexed with hen |
PDB Entry: 1uiq (more details), 2 Å
SCOPe Domain Sequences for d1uiqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uiqb_ c.79.1.1 (B:) Threonine synthase {Thermus thermophilus [TaxId: 274]} mrpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsf kdrgmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqs lvhgarivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaph yhalpvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlata irignpaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkl lregrlepestvvltltghglkdpataervaelpppvparleavaaaagll
Timeline for d1uiqb_: