SCOPe 2.06: Domain d1uiqb_: 1uiq B:

Lineage for d1uiqb_ (1uiq B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)

6. Protein Threonine synthase [64172] (4 species)

7. Species Thermus thermophilus [TaxId:274] [102667] (6 PDB entries)

8. Domain d1uiqb_: 1uiq B: [303140]
   automated match to d1v7ca_
   complexed with hen

Details for d1uiqb_

PDB Entry: 1uiq, 2 Å

PDB Description: Crystal Structure of Threonine Synthase from Thermus Thermophilus HB8 in complex with a substrate analogue

PDB Compounds: (B:) threonine synthase

SCOPe Domain Sequences for d1uiqb_:

Sequence; same for both SEQRES and ATOM records:

>d1uiqb_ c.79.1.1 (B:) Threonine synthase {Thermus thermophilus [TaxId: 274]}
mrpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsf
kdrgmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqs
lvhgarivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaph
yhalpvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlata
irignpaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkl
lregrlepestvvltltghglkdpataervaelpppvparleavaaaagll

Timeline for d1uiqb_:

• d1uiqb_ is new in SCOPe 2.06-stable
  
• d1uiqb_ appears in SCOPe 2.07
  
• d1uiqb_ appears in the current release, SCOPe 2.08