Lineage for d1djnb2 (1djn B:490-645)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849310Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (5 proteins)
  6. 2849367Protein Trimethylamine dehydrogenase, C-terminal domain [51907] (1 species)
    N-terminal domain is beta/alpha barrel and the middle domain is alpha/beta Rossmann-fold
  7. 2849368Species Methylophilus methylotrophus, w3a1 [TaxId:17] [51908] (5 PDB entries)
  8. 2849376Domain d1djnb2: 1djn B:490-645 [30314]
    Other proteins in same PDB: d1djna1, d1djna3, d1djnb1, d1djnb3
    complexed with adp, fmn, sf4

Details for d1djnb2

PDB Entry: 1djn (more details), 2.2 Å

PDB Description: structural and biochemical characterization of recombinant wild type trimethylamine dehydrogenase from methylophilus methylotrophus (sp. w3a1)
PDB Compounds: (B:) trimethylamine dehydrogenase

SCOPe Domain Sequences for d1djnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1djnb2 c.3.1.1 (B:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}
rwntdgtnclthdpipgadaslpdqltpeqvmdgkkkigkrvvilnadtyfmapslaekl
ataghevtivsgvhlanymhftleypnmmrrlhelhveelgdhfcsriepgrmeiyniwg
dgskrtyrgpgvsprdantshrwiefdslvlvtgrh

SCOPe Domain Coordinates for d1djnb2:

Click to download the PDB-style file with coordinates for d1djnb2.
(The format of our PDB-style files is described here.)

Timeline for d1djnb2: