Class b: All beta proteins [48724] (177 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (2 families) |
Family b.69.8.1: Integrin alpha N-terminal domain [69319] (2 proteins) |
Protein Integrin alpha N-terminal domain [69320] (2 species) |
Species Human (Homo sapiens), isoform IIb [TaxId:9606] [117285] (24 PDB entries) Uniprot P08514 32-483 |
Domain d1ty7a_: 1ty7 A: [303132] Other proteins in same PDB: d1ty7l3, d1ty7l4 automated match to d3niga_ complexed with 180, ca, gol, mg, nag, ndg |
PDB Entry: 1ty7 (more details), 3.1 Å
SCOPe Domain Sequences for d1ty7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ty7a_ b.69.8.1 (A:) Integrin alpha N-terminal domain {Human (Homo sapiens), isoform IIb [TaxId: 9606]} lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlraeqmasyfghsvavtdvng dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs lrgavdiddngypdlivgayganqvavyraqp
Timeline for d1ty7a_: