| Class b: All beta proteins [48724] (177 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (16 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries) |
| Domain d1ty6l4: 1ty6 L:108-214 [303131] Other proteins in same PDB: d1ty6a_, d1ty6b4, d1ty6b5, d1ty6b6, d1ty6l3 automated match to d1tqbc2 complexed with ca, gol, mg, nag, ndg |
PDB Entry: 1ty6 (more details), 2.9 Å
SCOPe Domain Sequences for d1ty6l4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ty6l4 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1ty6l4:
View in 3DDomains from other chains: (mouse over for more information) d1ty6a_, d1ty6b4, d1ty6b5, d1ty6b6 |