Class b: All beta proteins [48724] (177 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (2 families) |
Family b.69.8.1: Integrin alpha N-terminal domain [69319] (2 proteins) |
Protein Integrin alpha N-terminal domain [69320] (2 species) |
Species Human (Homo sapiens), isoform IIb [TaxId:9606] [117285] (24 PDB entries) Uniprot P08514 32-483 |
Domain d1ty6a_: 1ty6 A: [303126] Other proteins in same PDB: d1ty6b4, d1ty6b5, d1ty6b6, d1ty6l3, d1ty6l4 automated match to d1tyee_ complexed with ca, gol, mg, nag, ndg |
PDB Entry: 1ty6 (more details), 2.9 Å
SCOPe Domain Sequences for d1ty6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ty6a_ b.69.8.1 (A:) Integrin alpha N-terminal domain {Human (Homo sapiens), isoform IIb [TaxId: 9606]} lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlraeqmasyfghsvavtdvng dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs lrgavdiddngypdlivgayganqvavyraqp
Timeline for d1ty6a_: