SCOPe 2.07: Domain d1ty5l4: 1ty5 L:108-214

Lineage for d1ty5l4 (1ty5 L:108-214)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d1ty5l4: 1ty5 L:108-214 [303125]
   Other proteins in same PDB: d1ty5a_, d1ty5b4, d1ty5b5, d1ty5b6, d1ty5l3
   automated match to d1tqbc2
   complexed with agg, ca, gol, mg, nag, ndg

Details for d1ty5l4

PDB Entry: 1ty5, 2.9 Å

PDB Description: Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen

PDB Compounds: (L:) monoclonal antibody 10e5 light chain

SCOPe Domain Sequences for d1ty5l4:

Sequence; same for both SEQRES and ATOM records:

>d1ty5l4 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1ty5l4:

• d1ty5l4 first appeared in SCOPe 2.06
  
• d1ty5l4 appears in the current release, SCOPe 2.08