Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.62.1: vWA-like [53300] (6 families) |
Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins) |
Protein Integrin beta A domain [69542] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [69543] (9 PDB entries) Uniprot P05106 27-716 ! Uniprot P05106 27-466 |
Domain d1ty5b6: 1ty5 B:107-354 [303123] Other proteins in same PDB: d1ty5a_, d1ty5b4, d1ty5b5, d1ty5h_, d1ty5l3, d1ty5l4 automated match to d1tyed2 complexed with agg, ca, gol, mg, nag, ndg |
PDB Entry: 1ty5 (more details), 2.9 Å
SCOPe Domain Sequences for d1ty5b6:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ty5b6 c.62.1.1 (B:107-354) Integrin beta A domain {Human (Homo sapiens) [TaxId: 9606]} vedypvdiyylmdlsysmkddlwsiqnlgtklatqmrkltsnlrigfgafvdkpvspymy isppealenpcydmkttclpmfgykhvltltdqvtrfneevkkqsvsrnrdapeggfdai mqatvcdekigwrndashllvfttdakthialdgrlagivqpndgqchvgsdnhysastt mdypslglmteklsqkninlifavtenvvnlyqnyselipgttvgvlsmdssnvlqlivd aygkirsk
Timeline for d1ty5b6:
View in 3D Domains from other chains: (mouse over for more information) d1ty5a_, d1ty5h_, d1ty5l3, d1ty5l4 |