Lineage for d1ty3b4 (1ty3 B:1-57)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638254Fold g.16: Trefoil/Plexin domain-like [57491] (3 superfamilies)
    disulfide-rich fold; common core is alpha+beta with two conserved disulfides
  4. 2638289Superfamily g.16.2: Plexin repeat [103575] (1 family) (S)
  5. 2638290Family g.16.2.1: Plexin repeat [103576] (3 proteins)
    Pfam PF01437
  6. 2638296Protein Integrin beta-3 [118249] (1 species)
  7. 2638297Species Human (Homo sapiens) [TaxId:9606] [118250] (6 PDB entries)
    Uniprot P05106 27-716 ! Uniprot P05106 27-466
  8. 2638299Domain d1ty3b4: 1ty3 B:1-57 [303115]
    Other proteins in same PDB: d1ty3a_, d1ty3b5, d1ty3b6, d1ty3l3, d1ty3l4
    automated match to d1tyed3
    complexed with ca, cac, gol, mg, nag, ndg

Details for d1ty3b4

PDB Entry: 1ty3 (more details), 2.8 Å

PDB Description: Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen
PDB Compounds: (B:) integrin beta-3

SCOPe Domain Sequences for d1ty3b4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ty3b4 g.16.2.1 (B:1-57) Integrin beta-3 {Human (Homo sapiens) [TaxId: 9606]}
gpnicttrgvsscqqclavspmcawcsdealplgsprcdlkenllkdncapesiefp

SCOPe Domain Coordinates for d1ty3b4:

Click to download the PDB-style file with coordinates for d1ty3b4.
(The format of our PDB-style files is described here.)

Timeline for d1ty3b4: