SCOPe 2.07: Domain d1ty3b4: 1ty3 B:1-57

Lineage for d1ty3b4 (1ty3 B:1-57)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.16: Trefoil/Plexin domain-like [57491] (3 superfamilies)
   disulfide-rich fold; common core is alpha+beta with two conserved disulfides

4. Superfamily g.16.2: Plexin repeat [103575] (1 family)

5. Family g.16.2.1: Plexin repeat [103576] (3 proteins)
   Pfam PF01437

6. Protein Integrin beta-3 [118249] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [118250] (6 PDB entries)
   Uniprot P05106 27-716 ! Uniprot P05106 27-466

8. Domain d1ty3b4: 1ty3 B:1-57 [303115]
   Other proteins in same PDB: d1ty3a_, d1ty3b5, d1ty3b6, d1ty3l3, d1ty3l4
   automated match to d1tyed3
   complexed with ca, cac, gol, mg, nag, ndg

Details for d1ty3b4

PDB Entry: 1ty3, 2.8 Å

PDB Description: Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen

PDB Compounds: (B:) integrin beta-3

SCOPe Domain Sequences for d1ty3b4:

Sequence; same for both SEQRES and ATOM records:

>d1ty3b4 g.16.2.1 (B:1-57) Integrin beta-3 {Human (Homo sapiens) [TaxId: 9606]}
gpnicttrgvsscqqclavspmcawcsdealplgsprcdlkenllkdncapesiefp

Timeline for d1ty3b4:

• d1ty3b4 first appeared in SCOPe 2.06
  
• d1ty3b4 appears in the current release, SCOPe 2.08