SCOPe 2.08: Domain d1txwl_: 1txw L:

Lineage for d1txwl_ (1txw L:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (4 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [81474] (21 PDB entries)

8. Domain d1txwl_: 1txw L: [303112]
   Other proteins in same PDB: d1txwc_, d1txwh1, d1txwh2, d1txwm_
   automated match to d6prcl_
   complexed with bcb, bpb, fe2, hem, lda, mq9, ns5, so4, uq2

Details for d1txwl_

PDB Entry: 1txw, 2.1 Å

PDB Description: photosynthetic reaction center blastochloris viridis (atcc)

PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d1txwl_:

Sequence; same for both SEQRES and ATOM records:

>d1txwl_ f.26.1.1 (L:) L (light) subunit {Rhodopseudomonas viridis [TaxId: 1079]}
allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
fltgafgtiasgpfwtrgwpewwgwwldipfws

Timeline for d1txwl_:

• d1txwl_ first appeared in SCOPe 2.06
  
• d1txwl_ appears in SCOPe 2.07