Lineage for d1txvb5 (1txv B:58-106,B:355-440)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038467Superfamily b.1.15: Integrin domains [69179] (2 families) (S)
  5. 2038468Family b.1.15.1: Integrin domains [69180] (2 proteins)
  6. 2038469Protein Hybrid domain of integrin beta [69183] (1 species)
  7. 2038470Species Human (Homo sapiens) [TaxId:9606] [69184] (9 PDB entries)
    Uniprot P05106 27-466
  8. 2038471Domain d1txvb5: 1txv B:58-106,B:355-440 [303105]
    Other proteins in same PDB: d1txva_, d1txvb4, d1txvb6, d1txvl3, d1txvl4
    automated match to d1tyed1
    complexed with ca, cac, gol, mg, nag, ndg

Details for d1txvb5

PDB Entry: 1txv (more details), 2.75 Å

PDB Description: Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen
PDB Compounds: (B:) integrin beta-3

SCOPe Domain Sequences for d1txvb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1txvb5 b.1.15.1 (B:58-106,B:355-440) Hybrid domain of integrin beta {Human (Homo sapiens) [TaxId: 9606]}
vsearvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqXvelevrdlpe
elslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvgfkds
livqvtfdcdcacqaq

SCOPe Domain Coordinates for d1txvb5:

Click to download the PDB-style file with coordinates for d1txvb5.
(The format of our PDB-style files is described here.)

Timeline for d1txvb5: