| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.15: Integrin domains [69179] (2 families) ![]() |
| Family b.1.15.1: Integrin domains [69180] (2 proteins) |
| Protein Hybrid domain of integrin beta [69183] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [69184] (9 PDB entries) Uniprot P05106 27-466 |
| Domain d1txvb5: 1txv B:58-106,B:355-440 [303105] Other proteins in same PDB: d1txva_, d1txvb4, d1txvb6, d1txvh_, d1txvl3, d1txvl4 automated match to d1tyed1 complexed with ca, cac, gol, mg, nag, ndg |
PDB Entry: 1txv (more details), 2.75 Å
SCOPe Domain Sequences for d1txvb5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1txvb5 b.1.15.1 (B:58-106,B:355-440) Hybrid domain of integrin beta {Human (Homo sapiens) [TaxId: 9606]}
vsearvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqXvelevrdlpe
elslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvgfkds
livqvtfdcdcacqaq
Timeline for d1txvb5:
View in 3DDomains from other chains: (mouse over for more information) d1txva_, d1txvh_, d1txvl3, d1txvl4 |