SCOPe 2.06: Domain d1cqid1: 1cqi D:1-121

Lineage for d1cqid1 (1cqi D:1-121)

Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similar

Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)
Family c.2.1.8: CoA-binding domain [51900] (6 proteins)
Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (5 species)
Species Escherichia coli [TaxId:562] [51902] (11 PDB entries)
Domain d1cqid1: 1cqi D:1-121 [30310]
Other proteins in same PDB: d1cqia2, d1cqib1, d1cqib2, d1cqid2, d1cqie1, d1cqie2
complexed with adp, coa, mg, po4

Details for d1cqid1

PDB Entry: 1cqi (more details), 3.3 Å

PDB Description: crystal structure of the complex of adp and mg2+ with dephosphorylated e. coli succinyl-coa synthetase

PDB Compounds: (D:) protein (succinyl-coa synthetase alpha chain)

SCOPe Domain Sequences for d1cqid1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cqid1 c.2.1.8 (D:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]}
silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
p

SCOPe Domain Coordinates for d1cqid1:

Click to download the PDB-style file with coordinates for d1cqid1.
(The format of our PDB-style files is described here.)

Timeline for d1cqid1: