Lineage for d1tgqa_ (1tgq A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2971065Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families) (S)
    alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices
  5. 2971066Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
    Pfam PF03259
  6. 2971067Protein Dynein light chain 2A, cytoplasmic [118074] (2 species)
  7. 2971068Species Human (Homo sapiens) [TaxId:9606] [118075] (3 PDB entries)
    Uniprot Q9NP97
  8. 2971072Domain d1tgqa_: 1tgq A: [303090]
    automated match to d1z09a_

Details for d1tgqa_

PDB Entry: 1tgq (more details)

PDB Description: Solution NMR Structure of Protein Dynein Light Chain 2A, Cytoplasmic; Northeast Structural Genomics Consortium Target HR2106
PDB Compounds: (A:) Dynein light chain 2A, cytoplasmic

SCOPe Domain Sequences for d1tgqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tgqa_ d.110.7.1 (A:) Dynein light chain 2A, cytoplasmic {Human (Homo sapiens) [TaxId: 9606]}
maeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkarstvrdi
dpqndltflrirskkneimvapdkdyfliviqnpte

SCOPe Domain Coordinates for d1tgqa_:

Click to download the PDB-style file with coordinates for d1tgqa_.
(The format of our PDB-style files is described here.)

Timeline for d1tgqa_: