Lineage for d1cqia1 (1cqi A:1-121)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 67046Family c.2.1.8: Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51900] (1 protein)
  6. 67047Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (2 species)
  7. 67048Species Escherichia coli [TaxId:562] [51902] (4 PDB entries)
  8. 67055Domain d1cqia1: 1cqi A:1-121 [30309]
    Other proteins in same PDB: d1cqia2, d1cqib1, d1cqib2, d1cqid2, d1cqie1, d1cqie2

Details for d1cqia1

PDB Entry: 1cqi (more details), 3.3 Å

PDB Description: crystal structure of the complex of adp and mg2+ with dephosphorylated e. coli succinyl-coa synthetase

SCOP Domain Sequences for d1cqia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cqia1 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli}
silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
p

SCOP Domain Coordinates for d1cqia1:

Click to download the PDB-style file with coordinates for d1cqia1.
(The format of our PDB-style files is described here.)

Timeline for d1cqia1: