SCOPe 2.03: Domain d1scud1: 1scu D:1-121

Lineage for d1scud1 (1scu D:1-121)

Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similar

Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)
Family c.2.1.8: CoA-binding domain [51900] (6 proteins)
Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (5 species)
Species Escherichia coli [TaxId:562] [51902] (11 PDB entries)
Domain d1scud1: 1scu D:1-121 [30308]
Other proteins in same PDB: d1scua2, d1scub1, d1scub2, d1scud2, d1scue1, d1scue2
complexed with coa

Details for d1scud1

PDB Entry: 1scu (more details), 2.5 Å

PDB Description: the crystal structure of succinyl-coa synthetase from escherichia coli at 2.5 angstroms resolution

PDB Compounds: (D:) succinyl-coa synthetase, alpha subunit

SCOPe Domain Sequences for d1scud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1scud1 c.2.1.8 (D:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]}
silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
p

SCOPe Domain Coordinates for d1scud1:

Click to download the PDB-style file with coordinates for d1scud1.
(The format of our PDB-style files is described here.)

Timeline for d1scud1: