SCOPe 2.06: Domain d1sv8a4: 1sv8 A:241-308

Lineage for d1sv8a4 (1sv8 A:241-308)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
   secreted during involution

7. Species Buffalo (Bubalus bubalis) [TaxId:89462] [110873] (8 PDB entries)
   Uniprot Q7YS85

8. Domain d1sv8a4: 1sv8 A:241-308 [303077]
   Other proteins in same PDB: d1sv8a3
   automated match to d1tfva2

Details for d1sv8a4

PDB Entry: 1sv8, 2.8 Å

PDB Description: Crystal structure of a signaling protein from buffalo(SPB-40)at 2.8 A resolution using crystals grown in the prsence of carbohydrates

PDB Compounds: (A:) signalling protein spb

SCOPe Domain Sequences for d1sv8a4:

Sequence; same for both SEQRES and ATOM records:

>d1sv8a4 d.26.3.1 (A:241-308) Signal processing protein (SPC-40, MGP-40) {Buffalo (Bubalus bubalis) [TaxId: 89462]}
grsytlassktdvgapisgpgipgrftkwkgilayyeicdflhgatthrfrdqqvpyatk
gnqwvayd

Timeline for d1sv8a4:

• d1sv8a4 is new in SCOPe 2.06-stable
  
• d1sv8a4 appears in SCOPe 2.07
  
• d1sv8a4 appears in the current release, SCOPe 2.08