Lineage for d1scua1 (1scu A:1-121)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 67046Family c.2.1.8: Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51900] (1 protein)
  6. 67047Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (2 species)
  7. 67048Species Escherichia coli [TaxId:562] [51902] (4 PDB entries)
  8. 67053Domain d1scua1: 1scu A:1-121 [30307]
    Other proteins in same PDB: d1scua2, d1scub1, d1scub2, d1scud2, d1scue1, d1scue2

Details for d1scua1

PDB Entry: 1scu (more details), 2.5 Å

PDB Description: the crystal structure of succinyl-coa synthetase from escherichia coli at 2.5 angstroms resolution

SCOP Domain Sequences for d1scua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1scua1 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli}
silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
p

SCOP Domain Coordinates for d1scua1:

Click to download the PDB-style file with coordinates for d1scua1.
(The format of our PDB-style files is described here.)

Timeline for d1scua1: