Lineage for d1cqjd1 (1cqj D:1-121)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 67046Family c.2.1.8: Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51900] (1 protein)
  6. 67047Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (2 species)
  7. 67048Species Escherichia coli [TaxId:562] [51902] (4 PDB entries)
  8. 67052Domain d1cqjd1: 1cqj D:1-121 [30306]
    Other proteins in same PDB: d1cqja2, d1cqjb1, d1cqjb2, d1cqjd2, d1cqje1, d1cqje2

Details for d1cqjd1

PDB Entry: 1cqj (more details), 2.9 Å

PDB Description: crystal structure of dephosphorylated e. coli succinyl-coa synthetase

SCOP Domain Sequences for d1cqjd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cqjd1 c.2.1.8 (D:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli}
silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
p

SCOP Domain Coordinates for d1cqjd1:

Click to download the PDB-style file with coordinates for d1cqjd1.
(The format of our PDB-style files is described here.)

Timeline for d1cqjd1: