Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.8: CoA-binding domain [51900] (6 proteins) |
Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (5 species) |
Species Escherichia coli [TaxId:562] [51902] (11 PDB entries) |
Domain d2scud1: 2scu D:1-121 [30304] Other proteins in same PDB: d2scua2, d2scub1, d2scub2, d2scud2, d2scue1, d2scue2 complexed with coa, so4 |
PDB Entry: 2scu (more details), 2.3 Å
SCOPe Domain Sequences for d2scud1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2scud1 c.2.1.8 (D:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]} silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig p
Timeline for d2scud1: