SCOP 1.73: Domain d2scud1: 2scu D:1-121

Lineage for d2scud1 (2scu D:1-121)

Root: SCOP 1.73
Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similar

Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)
Family c.2.1.8: CoA-binding domain [51900] (5 proteins)
Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (3 species)
Species Escherichia coli [TaxId:562] [51902] (6 PDB entries)
Domain d2scud1: 2scu D:1-121 [30304]
Other proteins in same PDB: d2scua2, d2scub1, d2scub2, d2scud2, d2scue1, d2scue2
complexed with coa, so4

Details for d2scud1

PDB Entry: 2scu (more details), 2.3 Å

PDB Description: A detailed description of the structure of Succinyl-COA synthetase from Escherichia coli

PDB Compounds: (D:) protein (succinyl-coa ligase)

SCOP Domain Sequences for d2scud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2scud1 c.2.1.8 (D:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]}
silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
p

SCOP Domain Coordinates for d2scud1:

Click to download the PDB-style file with coordinates for d2scud1.
(The format of our PDB-style files is described here.)

Timeline for d2scud1: