Lineage for d2scua1 (2scu A:1-121)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 67046Family c.2.1.8: Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51900] (1 protein)
  6. 67047Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (2 species)
  7. 67048Species Escherichia coli [TaxId:562] [51902] (4 PDB entries)
  8. 67049Domain d2scua1: 2scu A:1-121 [30303]
    Other proteins in same PDB: d2scua2, d2scub1, d2scub2, d2scud2, d2scue1, d2scue2

Details for d2scua1

PDB Entry: 2scu (more details), 2.3 Å

PDB Description: A detailed description of the structure of Succinyl-COA synthetase from Escherichia coli

SCOP Domain Sequences for d2scua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2scua1 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli}
silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
p

SCOP Domain Coordinates for d2scua1:

Click to download the PDB-style file with coordinates for d2scua1.
(The format of our PDB-style files is described here.)

Timeline for d2scua1: