SCOPe 2.06: Domain d1rleb8: 1rle B:594-692

Lineage for d1rleb8 (1rle B:594-692)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families)
   automatically mapped to Pfam PF00927

5. Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)

6. Protein Transglutaminase, two C-terminal domains [49311] (4 species)
   duplication

7. Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74850] (9 PDB entries)

8. Domain d1rleb8: 1rle B:594-692 [303009]
   Other proteins in same PDB: d1rlea5, d1rlea6, d1rleb5, d1rleb6
   automated match to d1l9mb3
   complexed with ca, gsp, mg

Details for d1rleb8

PDB Entry: 1rle, 2.1 Å

PDB Description: Structural Basis for the Coordinated Regulation of Transglutaminase 3 by Guanine Nucleotides and Calcium/Magnesium

PDB Compounds: (B:) Protein-glutamine glutamyltransferase E

SCOPe Domain Sequences for d1rleb8:

Sequence; same for both SEQRES and ATOM records:

>d1rleb8 b.1.5.1 (B:594-692) Transglutaminase, two C-terminal domains {Human (Homo sapiens), TGase E3 [TaxId: 9606]}
ptltlevlnearvrkpvnvqmlfsnpldepvrdcvlmvegsglllgnlkidvptlgpker
srvrfdilpsrsgtkqlladfscnkfpaikamlsidvae

Timeline for d1rleb8:

• d1rleb8 is new in SCOPe 2.06-stable
  
• d1rleb8 appears in SCOPe 2.07
  
• d1rleb8 appears in the current release, SCOPe 2.08