Lineage for d1rlea7 (1rle A:479-593)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2037080Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) (S)
    automatically mapped to Pfam PF00927
  5. 2037081Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)
  6. 2037082Protein Transglutaminase, two C-terminal domains [49311] (4 species)
    duplication
  7. 2037120Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74850] (9 PDB entries)
  8. 2037137Domain d1rlea7: 1rle A:479-593 [303004]
    Other proteins in same PDB: d1rlea5, d1rlea6, d1rleb5, d1rleb6
    automated match to d1l9ma2
    complexed with ca, gsp, mg

Details for d1rlea7

PDB Entry: 1rle (more details), 2.1 Å

PDB Description: Structural Basis for the Coordinated Regulation of Transglutaminase 3 by Guanine Nucleotides and Calcium/Magnesium
PDB Compounds: (A:) Protein-glutamine glutamyltransferase E

SCOPe Domain Sequences for d1rlea7:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rlea7 b.1.5.1 (A:479-593) Transglutaminase, two C-terminal domains {Human (Homo sapiens), TGase E3 [TaxId: 9606]}
epsiigklkvagmlavgkevnlvlllknlsrdtktvtvnmtawtiiyngtlvhevwkdsa
tmsldpeeeaehpikisyaqyerylksdnmiritavckvpdesevvverdiildn

SCOPe Domain Coordinates for d1rlea7:

Click to download the PDB-style file with coordinates for d1rlea7.
(The format of our PDB-style files is described here.)

Timeline for d1rlea7: