SCOP 1.67: Domain d1efkb1: 1efk B:280-573

Lineage for d1efkb1 (1efk B:280-573)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (10 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein Mitochondrial NAD(P)-dependent malic enzyme [51898] (3 species)
   includes C-terminal additional subdomains

7. Species Human (Homo sapiens) [TaxId:9606] [51899] (10 PDB entries)

8. Domain d1efkb1: 1efk B:280-573 [30300]
   Other proteins in same PDB: d1efka2, d1efkb2, d1efkc2, d1efkd2

Details for d1efkb1

PDB Entry: 1efk, 2.6 Å

PDB Description: structure of human malic enzyme in complex with ketomalonate

SCOP Domain Sequences for d1efkb1:

Sequence; same for both SEQRES and ATOM records:

>d1efkb1 c.2.1.7 (B:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens)}
iqgtaavalagllaaqkviskpisehkilflgageaalgianlivmsmvenglseqeaqk
kiwmfdkygllvkgrkakidsyqepfthsapesipdtfedavnilkpstiigvagagrlf
tpdviramasinerpvifalsnptaqaectaeeaytltegrclfasgspfgpvkltdgrv
ftpgqgnnvyifpgvalavilcntrhisdsvfleaakaltsqltdeelaqgrlypplani
qevsiniaikvteylyankmafrypepedkakyvkertwrseydsllpdvyewp

Timeline for d1efkb1:

• d1efkb1 first appeared (with stable ids) in SCOP 1.55
  
• d1efkb1 appears in SCOP 1.65
  
• d1efkb1 appears in SCOP 1.69
  
• d1efkb1 appears in the current release, SCOPe 2.08