Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.38: Transcriptional repressor Rex, N-terminal domain [101007] (1 protein) |
Protein Transcriptional repressor Rex, N-terminal domain [101008] (1 species) AT-rich DNA-binding protein p25 |
Species Thermus aquaticus [TaxId:271] [101009] (3 PDB entries) Uniprot Q9X2V5; # CASP5 |
Domain d1r72c3: 1r72 C:4-77 [302974] Other proteins in same PDB: d1r72a4, d1r72b4, d1r72c4, d1r72d4, d1r72e4, d1r72f4, d1r72g4 automated match to d1xcba1 complexed with ca, mg, nad |
PDB Entry: 1r72 (more details), 2.9 Å
SCOPe Domain Sequences for d1r72c3:
Sequence, based on SEQRES records: (download)
>d1r72c3 a.4.5.38 (C:4-77) Transcriptional repressor Rex, N-terminal domain {Thermus aquaticus [TaxId: 271]} peaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygtrgvgyt vpvlkrelrhilgl
>d1r72c3 a.4.5.38 (C:4-77) Transcriptional repressor Rex, N-terminal domain {Thermus aquaticus [TaxId: 271]} peaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygytvpvlk relrhilgl
Timeline for d1r72c3: