SCOPe 2.06: Domain d1r72b3: 1r72 B:4-77

Lineage for d1r72b3 (1r72 B:4-77)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.38: Transcriptional repressor Rex, N-terminal domain [101007] (1 protein)

6. Protein Transcriptional repressor Rex, N-terminal domain [101008] (1 species)
   AT-rich DNA-binding protein p25

7. Species Thermus aquaticus [TaxId:271] [101009] (3 PDB entries)
   Uniprot Q9X2V5; # CASP5

8. Domain d1r72b3: 1r72 B:4-77 [302972]
   Other proteins in same PDB: d1r72a4, d1r72b4, d1r72c4, d1r72d4, d1r72e4, d1r72f4, d1r72g4
   automated match to d1xcba1
   complexed with ca, mg, nad

Details for d1r72b3

PDB Entry: 1r72, 2.9 Å

PDB Description: Crystal Structure of p25 from Thermus aquaticus

PDB Compounds: (B:) AT-rich DNA-binding protein p25

SCOPe Domain Sequences for d1r72b3:

Sequence, based on SEQRES records:

>d1r72b3 a.4.5.38 (B:4-77) Transcriptional repressor Rex, N-terminal domain {Thermus aquaticus [TaxId: 271]}
peaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygtrgvgyt
vpvlkrelrhilgl

Sequence, based on observed residues (ATOM records):

>d1r72b3 a.4.5.38 (B:4-77) Transcriptional repressor Rex, N-terminal domain {Thermus aquaticus [TaxId: 271]}
peaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsgytvpvlkr
elrhilgl

Timeline for d1r72b3:

• d1r72b3 is new in SCOPe 2.06-stable
  
• d1r72b3 appears in SCOPe 2.07
  
• d1r72b3 appears in the current release, SCOPe 2.08