Lineage for d1qj2h3 (1qj2 H:10-146)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2188935Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2188936Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) (S)
  5. 2189022Family d.41.1.0: automated matches [230464] (1 protein)
    not a true family
  6. 2189023Protein automated matches [230465] (4 species)
    not a true protein
  7. 2189052Species Pseudomonas carboxydovorans [311171] (1 PDB entry)
  8. 2189054Domain d1qj2h3: 1qj2 H:10-146 [302938]
    Other proteins in same PDB: d1qj2a3, d1qj2a4, d1qj2b4, d1qj2c3, d1qj2c4, d1qj2g3, d1qj2g4, d1qj2h4, d1qj2i3, d1qj2i4
    automated match to d1n62b1
    complexed with fad, fes, pcd

Details for d1qj2h3

PDB Entry: 1qj2 (more details), 2.2 Å

PDB Description: co dehydrogenase from oligotropha carboxidovorans
PDB Compounds: (H:) carbon monoxide dehydrogenase

SCOPe Domain Sequences for d1qj2h3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qj2h3 d.41.1.0 (H:10-146) automated matches {Pseudomonas carboxydovorans}
tsaeraeklqgmgckrkrvedirftegkgnyvddvklpgmlfgdfvrsshahariksidt
skakalpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevafvvakdryva
adaielvevdyeplpvl

SCOPe Domain Coordinates for d1qj2h3:

Click to download the PDB-style file with coordinates for d1qj2h3.
(The format of our PDB-style files is described here.)

Timeline for d1qj2h3: