SCOPe 2.07: Domain d1q9qa3: 1q9q A:1-107

Lineage for d1q9qa3 (1q9q A:1-107)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (51 PDB entries)

8. Domain d1q9qa3: 1q9q A:1-107 [302912]
   Other proteins in same PDB: d1q9qa4, d1q9qb3, d1q9qb4
   automated match to d3t65a1
   complexed with mg, zn

Details for d1q9qa3

PDB Entry: 1q9q, 1.49 Å

PDB Description: S25-2- a(2-8)-a(2-4)Kdo trisaccharide complex

PDB Compounds: (A:) S25-2 Fab (IgG1k) light chain

SCOPe Domain Sequences for d1q9qa3:

Sequence; same for both SEQRES and ATOM records:

>d1q9qa3 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltitsvqaedlavyyckqsynlrtfgggtkleikr

Timeline for d1q9qa3:

• d1q9qa3 first appeared in SCOPe 2.06
  
• d1q9qa3 appears in the current release, SCOPe 2.08