SCOPe 2.07: Domain d1pxfa1: 1pxf A:1-110

Lineage for d1pxfa1 (1pxf A:1-110)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.4: Myf domain [50277] (7 proteins)

6. Protein Structure-specific tRNA-binding protein TRBP111 [89328] (2 species)

7. Species Escherichia coli [TaxId:562] [89329] (2 PDB entries)
   YgjH

8. Domain d1pxfa1: 1pxf A:1-110 [302900]
   Other proteins in same PDB: d1pxfa2
   automated match to d3ersx_

Details for d1pxfa1

PDB Entry: 1pxf, 1.87 Å

PDB Description: Crystal Structure of Trbp111: a Structure Specific tRNA Binding Protein

PDB Compounds: (A:) Hypothetical protein ygjH

SCOPe Domain Sequences for d1pxfa1:

Sequence; same for both SEQRES and ATOM records:

>d1pxfa1 b.40.4.4 (A:1-110) Structure-specific tRNA-binding protein TRBP111 {Escherichia coli [TaxId: 562]}
metvayadfarlemrvgkivevkrhenadklyivqvdvgqktlqtvtslvpyyseeelmg
ktvvvlcnlqkakmrgetsecmllcaetddgsesvlltpermmpagvrvv

Timeline for d1pxfa1:

• d1pxfa1 first appeared in SCOPe 2.06
  
• d1pxfa1 appears in the current release, SCOPe 2.08