Lineage for d1ojsa4 (1ojs A:164-331)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2232528Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2232529Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2232530Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2232537Protein Lactate dehydrogenase [56339] (19 species)
  7. 2232538Species Archaeoglobus fulgidus [TaxId:2234] [111253] (4 PDB entries)
    Uniprot O08349
  8. 2232540Domain d1ojsa4: 1ojs A:164-331 [302860]
    Other proteins in same PDB: d1ojsa3
    automated match to d2x0ia2
    complexed with na, nad, so4

Details for d1ojsa4

PDB Entry: 1ojs (more details), 2.9 Å

PDB Description: 2.9 a resolution structure of malate dehydrogenase from archaeoglobus fulgidus in complex with nadh.
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d1ojsa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ojsa4 d.162.1.1 (A:164-331) Lactate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]}
gnqldsqrlkerlynagarnirrawiigehgdsmfvaksladfdgevdweavendvrfva
aevikrkgatifgpavaiyrmvkavvedtgeiiptsmilqgeygienvavgvpaklgkng
aevadiklsdeeieklrnsakilrerleelgy

SCOPe Domain Coordinates for d1ojsa4:

Click to download the PDB-style file with coordinates for d1ojsa4.
(The format of our PDB-style files is described here.)

Timeline for d1ojsa4:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ojsa3