Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (83 species) not a true protein |
Species Escherichia coli [311165] (2 PDB entries) |
Domain d1oeqa4: 1oeq A:254-406 [302818] Other proteins in same PDB: d1oeqa3, d1oeqb3, d1oeqc3, d1oeqd3 automated match to d2vbac2 complexed with hyd, nh4; mutant |
PDB Entry: 1oeq (more details), 1.7 Å
SCOPe Domain Sequences for d1oeqa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oeqa4 c.95.1.0 (A:254-406) automated matches {Escherichia coli} yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai revfgdkspaisataamtghslgakgvqeaiysllmlehgfiapsinieeldeqaaglni vtettdrelttvmsnsfgfggtnatlvmrklkd
Timeline for d1oeqa4: