Lineage for d1bw9a1 (1bw9 A:149-350)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 175017Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 175018Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 175982Family c.2.1.7: Amino-acid dehydrogenase-like, C-terminal domain [51883] (5 proteins)
  6. 176113Protein Phenylalanine dehydrogenase [51892] (1 species)
  7. 176114Species Rhodococcus sp., M4 [TaxId:1831] [51893] (4 PDB entries)
  8. 176119Domain d1bw9a1: 1bw9 A:149-350 [30274]
    Other proteins in same PDB: d1bw9a2, d1bw9b2

Details for d1bw9a1

PDB Entry: 1bw9 (more details), 1.5 Å

PDB Description: phenylalanine dehydrogenase structure in ternary complex with nad+ and phenylpyruvate

SCOP Domain Sequences for d1bw9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bw9a1 c.2.1.7 (A:149-350) Phenylalanine dehydrogenase {Rhodococcus sp., M4}
safttavgvfeamkatvahrglgsldgltvlvqglgavggslaslaaeagaqllvadtdt
ervahavalghtavaledvlstpcdvfapcamggvittevartldcsvvagaannviade
aasdilhargilyapdfvanaggaihlvgrevlgwsesvvheravaigdtlnqvfeisdn
dgvtpdeaartlagrrareast

SCOP Domain Coordinates for d1bw9a1:

Click to download the PDB-style file with coordinates for d1bw9a1.
(The format of our PDB-style files is described here.)

Timeline for d1bw9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bw9a2