Lineage for d1m2ya_ (1m2y A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262912Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2263118Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 2263119Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 2263245Protein automated matches [190785] (5 species)
    not a true protein
  7. 2263256Species Pyrococcus furiosus [311162] (1 PDB entry)
  8. 2263257Domain d1m2ya_: 1m2y A: [302720]
    automated match to d4ar6a_
    mutant

Details for d1m2ya_

PDB Entry: 1m2y (more details)

PDB Description: Backbone NMR structure of a mutant P. furiosus rubredoxin using residual dipolar couplings
PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d1m2ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m2ya_ g.41.5.1 (A:) automated matches {Pyrococcus furiosus}
akyvckicgyiydedagdpdngvspgtkfeeipddwvcpicgapksefek

SCOPe Domain Coordinates for d1m2ya_:

Click to download the PDB-style file with coordinates for d1m2ya_.
(The format of our PDB-style files is described here.)

Timeline for d1m2ya_: