Lineage for d1c1xa1 (1c1x A:149-348)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 238223Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 238224Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 239294Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (8 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 239436Protein Phenylalanine dehydrogenase [51892] (1 species)
  7. 239437Species Rhodococcus sp., M4 [TaxId:1831] [51893] (4 PDB entries)
  8. 239440Domain d1c1xa1: 1c1x A:149-348 [30272]
    Other proteins in same PDB: d1c1xa2, d1c1xb2

Details for d1c1xa1

PDB Entry: 1c1x (more details), 1.4 Å

PDB Description: l-phenylalanine dehydrogenase structure in ternary complex with nad+ and l-3-phenyllactate

SCOP Domain Sequences for d1c1xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c1xa1 c.2.1.7 (A:149-348) Phenylalanine dehydrogenase {Rhodococcus sp., M4}
safttavgvfeamkatvahrglgsldgltvlvqglgavggslaslaaeagaqllvadtdt
ervahavalghtavaledvlstpcdvfapcamggvittevartldcsvvagaannviade
aasdilhargilyapdfvanaggaihlvgrevlgwsesvvheravaigdtlnqvfeisdn
dgvtpdeaartlagrrarea

SCOP Domain Coordinates for d1c1xa1:

Click to download the PDB-style file with coordinates for d1c1xa1.
(The format of our PDB-style files is described here.)

Timeline for d1c1xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c1xa2