Lineage for d1c1db1 (1c1d B:149-348)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 117972Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 117973Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 118878Family c.2.1.7: Amino-acid dehydrogenase-like, C-terminal domain [51883] (5 proteins)
  6. 118978Protein Phenylalanine dehydrogenase [51892] (1 species)
  7. 118979Species Rhodococcus sp., M4 [TaxId:1831] [51893] (4 PDB entries)
  8. 118981Domain d1c1db1: 1c1d B:149-348 [30271]
    Other proteins in same PDB: d1c1da2, d1c1db2

Details for d1c1db1

PDB Entry: 1c1d (more details), 1.25 Å

PDB Description: l-phenylalanine dehydrogenase structure in ternary complex with nadh and l-phenylalanine

SCOP Domain Sequences for d1c1db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c1db1 c.2.1.7 (B:149-348) Phenylalanine dehydrogenase {Rhodococcus sp., M4}
safttavgvfeamkatvahrglgsldgltvlvqglgavggslaslaaeagaqllvadtdt
ervahavalghtavaledvlstpcdvfapcamggvittevartldcsvvagaannviade
aasdilhargilyapdfvanaggaihlvgrevlgwsesvvheravaigdtlnqvfeisdn
dgvtpdeaartlagrrarea

SCOP Domain Coordinates for d1c1db1:

Click to download the PDB-style file with coordinates for d1c1db1.
(The format of our PDB-style files is described here.)

Timeline for d1c1db1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c1db2