SCOPe 2.08: Domain d1lkua1: 1lku A:5-138

Lineage for d1lkua1 (1lku A:5-138)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (104 PDB entries)
   Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595

8. Domain d1lkua1: 1lku A:5-138 [302707]
   Other proteins in same PDB: d1lkua2
   automated match to d1o1wa_

Details for d1lkua1

PDB Entry: 1lku

PDB Description: Solution Structure of the RNase H Domain of the HIV-1 Reverse Transcriptase in the Presence of Magnesium

PDB Compounds: (A:) Ribonuclease H

SCOPe Domain Sequences for d1lkua1:

Sequence; same for both SEQRES and ATOM records:

>d1lkua1 c.55.3.1 (A:5-138) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
yqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylal
qdsglevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggne
qvdklvsagirkvl

Timeline for d1lkua1:

• d1lkua1 first appeared in SCOPe 2.06
  
• d1lkua1 appears in SCOPe 2.07