SCOPe 2.06: Domain d1lixb5: 1lix B:440-573

Lineage for d1lixb5 (1lix B:440-573)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest

4. Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families)

5. Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
   automatically mapped to Pfam PF02887

6. Protein Pyruvate kinase, C-terminal domain [52937] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82431] (8 PDB entries)

8. Domain d1lixb5: 1lix B:440-573 [302697]
   Other proteins in same PDB: d1lixa4, d1lixa5, d1lixb4, d1lixc4, d1lixc5
   automated match to d2vgia3
   complexed with fbp, k, mn, pga; mutant

Details for d1lixb5

PDB Entry: 1lix, 2.87 Å

PDB Description: Human erythrocyte pyruvate kinase: Arg486Trp mutant

PDB Compounds: (B:) Pyruvate kinase, isozymes R/L

SCOPe Domain Sequences for d1lixb5:

Sequence; same for both SEQRES and ATOM records:

>d1lixb5 c.49.1.1 (B:440-573) Pyruvate kinase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
elrraaplsrdptevtaigaveaafkccaaaiivltttgrsaqllswyrpraaviavtrs
aqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfgiesgklrgflrvgdlvivvtgwr
pgsgytnimrvlsi

Timeline for d1lixb5:

• d1lixb5 is new in SCOPe 2.06-stable
  
• d1lixb5 appears in SCOPe 2.07
  
• d1lixb5 appears in the current release, SCOPe 2.08