Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.2: C-type lysozyme [53960] (3 proteins) automatically mapped to Pfam PF00062 |
Protein alpha-Lactalbumin [53975] (6 species) expressed only in the lactating mammary gland, strongly binds calcium ion |
Species Mouse (Mus musculus) [TaxId:10090] [69628] (14 PDB entries) |
Domain d1l7wc_: 1l7w C: [302663] Other proteins in same PDB: d1l7wb1, d1l7wb2, d1l7wd_ automated match to d1nmma_ complexed with ca, mn, ud2 |
PDB Entry: 1l7w (more details), 2.1 Å
SCOPe Domain Sequences for d1l7wc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l7wc_ d.2.1.2 (C:) alpha-Lactalbumin {Mouse (Mus musculus) [TaxId: 10090]} teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc ekp
Timeline for d1l7wc_:
View in 3D Domains from other chains: (mouse over for more information) d1l7wa_, d1l7wb1, d1l7wb2, d1l7wd_ |