Lineage for d1hwye1 (1hwy E:209-501)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 117972Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 117973Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 118878Family c.2.1.7: Amino-acid dehydrogenase-like, C-terminal domain [51883] (5 proteins)
  6. 118879Protein Glutamate dehydrogenase [51884] (6 species)
  7. 118905Species Cow (Bos taurus) [TaxId:9913] [51889] (3 PDB entries)
  8. 118922Domain d1hwye1: 1hwy E:209-501 [30266]
    Other proteins in same PDB: d1hwya2, d1hwyb2, d1hwyc2, d1hwyd2, d1hwye2, d1hwyf2

Details for d1hwye1

PDB Entry: 1hwy (more details), 3.2 Å

PDB Description: bovine glutamate dehydrogenase complexed with nad and 2-oxoglutarate

SCOP Domain Sequences for d1hwye1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwye1 c.2.1.7 (E:209-501) Glutamate dehydrogenase {Cow (Bos taurus)}
hgrisatgrgvfhgienfienasymsilgmtpgfgdktfavqgfgnvglhsmrylhrfga
kcvavgesdgsiwnpdgidpkeledfklqhgtilgfpkakiyegsilevdcdilipaase
kqltksnaprvkakiiaegangpttpqadkiflernimvipdlylnaggvtvsyfqilkn
lnhvsygrltfkyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdi
vhsglaytmersarqimrtamkynlgldlrtaayvnaiekvfrvyneagvtft

SCOP Domain Coordinates for d1hwye1:

Click to download the PDB-style file with coordinates for d1hwye1.
(The format of our PDB-style files is described here.)

Timeline for d1hwye1: