SCOPe 2.08: Domain d1jw7c_: 1jw7 C:

Lineage for d1jw7c_ (1jw7 C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein Enoyl-ACP reductase [51791] (11 species)

7. Species Helicobacter pylori [TaxId:210] [102151] (4 PDB entries)

8. Domain d1jw7c_: 1jw7 C: [302605]
   automated match to d2pd4a_
   complexed with dcn, nad

Details for d1jw7c_

PDB Entry: 1jw7, 2.3 Å

PDB Description: Crystal structure of Enoyl-Acyl Carrier protein Reductase from Helicobacter pylori

PDB Compounds: (C:) Enoyl-ACP reductase

SCOPe Domain Sequences for d1jw7c_:

Sequence; same for both SEQRES and ATOM records:

>d1jw7c_ c.2.1.2 (C:) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]}
gflkgkkglivgvannksiaygiaqscfnqgatlaftylneslekrvrpiaqelnspyvy
eldvskeehfkslynsvkkdlgsldfivhsvafapkealegslletsksafntameisvy
slieltntlkpllnngasvltlsylgstkymahynvmglakaalesavrylavdlgkhhi
rvnalsagpirtlassgiadfrmilkwneinaplrknvsleevgnagmyllsslssgvsg
evhfvdagyhvmgmgaveekdnkatllwdlhkeq

Timeline for d1jw7c_:

• d1jw7c_ first appeared in SCOPe 2.06
  
• d1jw7c_ appears in SCOPe 2.07