Lineage for d1jncc_ (1jnc C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2171118Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2171119Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2171157Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 2172311Protein automated matches [190299] (7 species)
    not a true protein
  7. 2172355Species Mus musculus [311150] (7 PDB entries)
  8. 2172365Domain d1jncc_: 1jnc C: [302599]
    Other proteins in same PDB: d1jncb1, d1jncb2
    automated match to d1yroa_
    complexed with ca, gud, mn

Details for d1jncc_

PDB Entry: 1jnc (more details), 2.3 Å

PDB Description: beta-1,4-galactosyltransferase complex with alpha-lactalbumin and UDP-glucose
PDB Compounds: (C:) alpha-lactalbumin

SCOPe Domain Sequences for d1jncc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jncc_ d.2.1.2 (C:) automated matches {Mus musculus}
teltkckvshaikdmdgyqgisllewtcvlfhtsgydsqavvndngsteyglfqiserfw
ckssefpesenicgiscdkllddeldddivcakkivaikgidywkaykpmcsekleqwrc
ekp

SCOPe Domain Coordinates for d1jncc_:

Click to download the PDB-style file with coordinates for d1jncc_.
(The format of our PDB-style files is described here.)

Timeline for d1jncc_: