Lineage for d1jh2m_ (1jh2 M:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785352Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2785353Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2785354Family b.35.1.1: GroES [50130] (2 proteins)
    automatically mapped to Pfam PF00166
  6. 2785355Protein Chaperonin-10 (GroES) [50131] (4 species)
  7. 2785414Species Mycobacterium tuberculosis [TaxId:1773] [63753] (3 PDB entries)
  8. 2785424Domain d1jh2m_: 1jh2 M: [302582]
    automated match to d1p3ha_
    complexed with mpd

Details for d1jh2m_

PDB Entry: 1jh2 (more details), 2.8 Å

PDB Description: Crystal structure of tetradecameric Mycobacterium tuberculosis chaperonin 10 at 2.8A resolution.
PDB Compounds: (M:) 10 kda chaperonin

SCOPe Domain Sequences for d1jh2m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jh2m_ b.35.1.1 (M:) Chaperonin-10 (GroES) {Mycobacterium tuberculosis [TaxId: 1773]}
kvnikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripld
vaegdtviyskyggteikyngeeylilsardvlavvsk

SCOPe Domain Coordinates for d1jh2m_:

Click to download the PDB-style file with coordinates for d1jh2m_.
(The format of our PDB-style files is described here.)

Timeline for d1jh2m_: